Description

  • Product name

    Recombinant Human TIAM2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEGPRENQDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELY LEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLE TPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFK AFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLKELVSLTDQESEEHYH LTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTELSMGE LLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPS NSRPAHNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIWELIHTKSEI EGRPETIFQLCCSDSESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDR LVPLKNRVPVSAKLASSRSLKVLKNSSSNEWTGETGKGTLLDSDEGSLSS GTQSSGCPTAEGRQDSKSTSPGKYPHPGLADFADNLIKESDILSDEDDDH RQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQKGGEQP KLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLE REFSVQSLTSVVSEECFYETESHGKS
    • Predicted molecular weight

      97 kDa including tags
    • Amino acids

      1 to 626

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ41865
    • OTTHUMP00000017472
    • SIF and TIAM1 like exchange factor
    • SIF and TIAM1-like exchange factor
    • STEF
    • T cell lymphoma invasion and metastasis 2
    • T lymphoma invasion and metastasis inducing protein 2
    • T-lymphoma invasion and metastasis-inducing protein 2
    • TIAM 2
    • TIAM-2
    • Tiam2
    • TIAM2_HUMAN
    see all
  • Function

    Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP-dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane (By similarity). Activates specifically RAC1, but not CDC42 and RHOA.
  • Tissue specificity

    Expressed in the occipital, frontal and temporal lobes, cerebellum, putamen and testis.
  • Sequence similarities

    Belongs to the TIAM family.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PDZ (DHR) domain.
    Contains 2 PH domains.
    Contains 1 RBD (Ras-binding) domain.
  • Domain

    The PH 1 domain and amino acids 621-782 (a region called TSS; otherwise known as CC-Ex) are necessary for membrane localization. The PH 1 and TSS domains are necessary for Rac1 activity. The PH 2 domain is engaged in the enhancement of the catalytic activity of the adjacent DH domain. The PH 1, TSS and DH domains are necessary to induce neurite-like structure.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues. Phosphorylated on Thr-1648 by Rho-kinase. Its phosphorylation by Rho-kinase inhibits its guanine nucleotide exchange activity, its interaction with MAP1A, MAP1B, PARP1 and YWHAE and reduces its ability to promote neurite growth.
  • Cellular localization

    Cytoplasm. Cell projection > lamellipodium. Cell projection > filopodium. Cell projection > growth cone. Localizes to the plasma membrane in neurites.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132621 stained with Coomassie Blue.

References

ab132621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up