Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYG DHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSSGKRSTG N
    • Amino acids

      141 to 241
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DnaJ (Hsp40) homolog subfamily A member 3
    • DnaJ homolog subfamily A member 3 mitochondrial precursor
    • DnaJ protein Tid 1
    • DnaJ protein Tid1
    • FLJ45758
    • HCA57
    • Hepatocellular carcinoma associated antigen 57
    • Highly similar to HYPOTHETICAL 105.9 KD PROTEIN F22B7.5 IN CHROMOSOME
    • hTid 1
    • hTid1
    • III [Caenorhabditis elegans]
    • TID1
    • Tumorous imaginal discs (Drosophila) homolog
    • Tumorous imaginal discs protein Tid56 homolog
    see all
  • Relevance

    TID1 is a human homolog of the Drosophila tumor suppressor lethal tumerous imaginal discs and encodes two mitochondrial matrix localized splice variants of human Tid1 designated hTid1S and hTid1L. These proteins are the conserved members of the DnaJ family of proteins which act as cochaperons for mitochondrial Hsp70. They contain a conserved tetrahedrical J domain which binds to Hsp70 chaperones and activates their ATPase activity. Expression of hTid1L increases apoptosis induced by DNA damaging agents as mitomycin C and TNF alpha. A J domain mutant of hTid1L can dominantly suppress apoptosis and in sharp contrast the J domain mutant of hTid1S increases apoptosis. Expression of hTid1S and hTid1L affects cytochrome c release from the mitochondria and caspase 3 activation, while activation of caspase 8 is unaffected. It is strongly suggested that these two splice variants exert their anti and pro apoptotic effects through discrete substrates and activities. Hence the relative abundance of these proteins or their substrates may allow the mitochondria to dampen or enhance the apoptotic signals.
  • Cellular localization

    Mitochondrial

Images

  • ab160337 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up