Description

  • Product name

    Recombinant Human TIE1 protein (Fc Chimera)
    See all TIE1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Source: Insect cells. Purity: > 90%, by SDS-PAGE and visualised by silver stain. Endotoxin level: < 0.1 ng per µg sTIE-1/Fc.
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRT PPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNS PGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHE AQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGP GCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQC PGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQ NGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINC AAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSG FWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFS GDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLS RPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVP GPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQL YHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPG PISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASI QGLGDWSNTVEESTLGNGLQAEGPVQETRSDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Amino acids

      23 to 752
    • Additional sequence information

      Fused with the Fc region of Human IgG1 at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab54455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: PBS

  • Reconstitution
    The protein can be reconstituted in ddH2O or PBS to a concentration of 100µg/ml.

General Info

  • Alternative names

    • JKT 14
    • JTK14
    • TIE
    • Tie1
    • TIE1_HUMAN
    • Tyrosine Kinase with Immunoglobulin and Epidermal Growth Factor Homology Domains
    • Tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1
    • Tyrosine kinase with immunoglobulin-like and EGF-like domains 1
    • Tyrosine protein kinase receptor Tie 1
    • Tyrosine-protein kinase receptor Tie-1
    see all
  • Function

    Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.
  • Tissue specificity

    Specifically expressed in developing vascular endothelial cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.
    Contains 3 EGF-like domains.
    Contains 3 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab54455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab54455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up