Overview

  • Product name

    Recombinant Human TIG3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSV FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV GQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAG CSFAIRRYQKKATA
    • Molecular weight

      44 kDa including tags
    • Amino acids

      1 to 164

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

    Previously labelled as RARRES3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HRASLS4
    • MGC8906
    • RAR responsive protein TIG3
    • RAR-responsive protein TIG3
    • RARRES3
    • Retinic acid inducible gene 1
    • Retinoic acid receptor responder (tazarotene induced) 3
    • Retinoic acid receptor responder protein 3
    • Retinoid inducible gene 1 protein
    • Retinoid-inducible gene 1 protein
    • RIG 1
    • rig1
    • Tazarotene induced gene 3 protein
    • Tazarotene-induced gene 3 protein
    • TIG 3
    • TIG3
    • TIG3_HUMAN
    see all
  • Function

    Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the H-rev107 family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132497 stained with Coomassie Blue.

References

ab132497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up