Bioactive grade

Recombinant human TIGIT protein (Active) (ab224737)

Description

  • Product name

    Recombinant human TIGIT protein (Active)
    See all TIGIT proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab224737 at 2 μg/ml (100 μl/well) can bind Human CD155, Fc Tag with a linear range of 8-128 ng/ml.

    Measured by its binding ability in a functional ELISA. Immobilized ab224737 at 1 μg/ml (100 μl/well) can bind Human Nectin-3, Fc Tag with a linear range of 0.08-2.5 μg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNA DLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGR IFLEVLESSVAEHGARFQIP
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      22 to 141
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (AAI01290).

Specifications

Our Abpromise guarantee covers the use of ab224737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • DKFZp667A205
    • ENSMUSG00000071552
    • FLJ39873
    • RGD1563191
    • T cell immunoreceptor with Ig and ITIM domains
    • TIGIT
    • TIGIT_HUMAN
    • V-set and immunoglobulin domain containing 9
    • V-set and immunoglobulin domain-containing protein 9
    • V-set and transmembrane domain containing 3
    • V-set and transmembrane domain-containing protein 3
    • VSIG9
    • VSTM3
    • Washington University cell adhesion molecule
    • WUCAM
    see all
  • Function

    Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
  • Tissue specificity

    Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Anti-Human TIGIT MAb (Mouse IgG1) captured on CM5 chip via Anti-Mouse antibodies surface, can bind Human TIGIT, His Tag with an affinity constant of 3.93 nM as determined in a SPR assay (Biacore T200).
  • FACS assay shows that Human TIGIT, His Tag can bind to 293T cell overexpressing human CD155. The concentration of TIGIT used is 0.3 µg/mL.
  • Serial dilutions of TIGIT antibody antibody (1:2 serial dilutions, from 20 µg/mL to 0.0097 µg/mL) were added into Human TIGIT, His Tag : Biotinylated Human CD155, Fc Tag binding reactions. Background was subtracted from data points before curve fitting.
  • ab224737 analyzed by SDS-PAGE under reducing conditions and stained overnight with Coomassie Blue.

  • Immobilized ab224737 at 2 μg/ml (100 μl/well) can bind Human CD155, Fc Tag with a linear range of 8-128 ng/ml.

  • Immobilized ab224737 at 1 μg/ml (100 μl/well) can bind Human Nectin-3, Fc Tag with a linear range of 0.08-2.5 μg/ml.

References

ab224737 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up