For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-tigit-protein-fc-chimera-active-ab223110.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity T Cells Non-CD
Share by email
Bioactive grade

Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

ELISA - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
  • Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
  • SDS-PAGE - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
  • Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
  • Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: Fc tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE, Flow Cyt, ELISA

You may also be interested in

Protein
Product image
Recombinant human CD86 protein (Fc Chimera) (ab167720)
Protein
Product image
Recombinant human CTLA4 protein (Active) (ab167727)
Protein
Product image
Recombinant human PD-L1 protein (Active) (ab280943)

View more associated products

Description

  • Product name

    Recombinant human TIGIT protein (Fc Chimera Active)
    See all TIGIT proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant human Poliovirus Receptor/PVR protein (ab220561) at 5 μg/mL (100 μL/well) can bind ab223110 with a linear range of 0.5-8 ng/mL.

    Measured by its binding ability in a BLI assay. Loaded ab223110 on Protein A Biosensor, can bind Recombinant human Poliovirus Receptor/PVR protein (ab155723) with an affinity constant of 0.92 μM as determined in BLI assay.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    Q495A1
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNA DLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGR IFLEVLESSVAEHGARFQIP
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      22 to 141
    • Tags

      Fc tag C-Terminus
    • Additional sequence information

      Topological domain fused with mouse IgG2a Fc tag at C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab223110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Flow Cytometry

    ELISA

  • Form

    Lyophilized
  • Additional notes

    This product is stable after storage at:

    • -20°C to -70°C for 12 months in lyophilized state;
    • -70°C for 3 months under sterile conditions after reconstitution.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    pH: 7.4
    Constituents: Glycine, 5% Trehalose, 0.61% Tris, L-Arginine, Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

General Info

  • Alternative names

    • DKFZp667A205
    • ENSMUSG00000071552
    • FLJ39873
    • RGD1563191
    • T cell immunoreceptor with Ig and ITIM domains
    • TIGIT
    • TIGIT_HUMAN
    • V-set and immunoglobulin domain containing 9
    • V-set and immunoglobulin domain-containing protein 9
    • V-set and transmembrane domain containing 3
    • V-set and transmembrane domain-containing protein 3
    • VSIG9
    • VSTM3
    • Washington University cell adhesion molecule
    • WUCAM
    see all
  • Function

    Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
  • Tissue specificity

    Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession Q495A1 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • ELISA - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
    ELISA - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

    Immobilized Recombinant human Poliovirus Receptor/PVR protein (ab220561) at 5 μg/mL (100 μL/well) can bind ab223110 with a linear range of 0.5-8 ng/mL.

  • Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
    Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

    Loaded ab223110 on Protein A Biosensor, can bind Recombinant human Poliovirus Receptor/PVR protein (ab155723) with an affinity constant of 0.92 μM as determined in BLI assay.

  • SDS-PAGE - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
    SDS-PAGE - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

    ab223110 analyzed by reduced SDS-PAGE and stained overnight with Coomassie Blue.  The protein migrates as 42-50 kDa under reducing conditions due to glycosylation.

     

  • Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
    Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

    FACS assay shows that recombinant Human TIGIT Protein, Mouse IgG2a Fc Tag (ab223110) can bind to 293T cell overexpressing human CD155. The concentration of TIGIT used is 0.03 μg/ml

  • Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
    Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)

    Serial dilutions of TIGIT antibody antibody (1:2 serial dilutions, from 20 μg/mL to 0.0097 μg/mL) were added into Human TIGIT (ab223110): Biotinylated Human CD112, Fc Tag (ab246048) binding reactions. Background was subtracted from data points before curve fitting.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab223110? Please let us know so that we can cite the reference in this datasheet.

ab223110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab223110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.