Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant human TIGIT protein (Fc Chimera Active)
See all TIGIT proteins and peptides -
Biological activity
Immobilized Human CD155 with Fc Tag at 5 μg/mL can bind ab223110 with a linear range of 3.9-62.5 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNA DLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGR IFLEVLESSVAEHGARFQIP -
Predicted molecular weight
40 kDa including tags -
Amino acids
22 to 141 -
Additional sequence information
Topological domain fused with mouse IgG2a Fc tag at C-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab223110 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.5
Constituents: 0.75% Glycine, 5% Trehalose, 0.61% Tris
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- DKFZp667A205
- ENSMUSG00000071552
- FLJ39873
see all -
Function
Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells. -
Tissue specificity
Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level). -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Domain
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)Serial dilutions of TIGIT antibody antibody (1:2 serial dilutions, from 20 μg/mL to 0.0097 μg/mL) were added into Human TIGIT (ab223110): Biotinylated Human CD112, Fc Tag (ab246048) binding reactions. The assay was performed according to the above described protocol. Background was subtracted from data points before curve fitting.
-
Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)FACS assay shows that recombinant Human TIGIT Protein, Mouse IgG2a Fc Tag (ab223110) can bind to 293T cell overexpressing human CD155. The concentration of TIGIT used is 0.03 μg/ml
-
SDS-PAGE - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)ab223110 analyzed by reduced SDS-PAGE and stained overnight with Coomassie Blue. The protein migrates as 42-50 kDa under reducing conditions due to glycosylation.
-
Functional Studies - Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)Immobilized Human CD155, Fc Tag at 5 μg/mL (100 μL/well) can bind ab223110 (0.5 µg per well) with a linear range of 3.9-62.5 ng/mL.
Datasheets and documents
References
ab223110 has not yet been referenced specifically in any publications.
