Recombinant human TIGIT protein (Fc Chimera Active) (ab223110)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE, Flow Cyt, ELISA
Description
-
Product name
Recombinant human TIGIT protein (Fc Chimera Active)
See all TIGIT proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant human Poliovirus Receptor/PVR protein (ab220561) at 5 μg/mL (100 μL/well) can bind ab223110 with a linear range of 0.5-8 ng/mL.
Measured by its binding ability in a BLI assay. Loaded ab223110 on Protein A Biosensor, can bind Recombinant human Poliovirus Receptor/PVR protein (ab155723) with an affinity constant of 0.92 μM as determined in BLI assay.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNA DLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGR IFLEVLESSVAEHGARFQIP -
Predicted molecular weight
40 kDa including tags -
Amino acids
22 to 141 -
Tags
Fc tag C-Terminus -
Additional sequence information
Topological domain fused with mouse IgG2a Fc tag at C-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab223110 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Flow Cytometry
ELISA
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4
Constituents: Glycine, 5% Trehalose, 0.61% Tris, L-Arginine, Sodium chloride
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- DKFZp667A205
- ENSMUSG00000071552
- FLJ39873
see all -
Function
Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells. -
Tissue specificity
Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level). -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Domain
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
Immobilized Recombinant human Poliovirus Receptor/PVR protein (ab220561) at 5 μg/mL (100 μL/well) can bind ab223110 with a linear range of 0.5-8 ng/mL.
-
Loaded ab223110 on Protein A Biosensor, can bind Recombinant human Poliovirus Receptor/PVR protein (ab155723) with an affinity constant of 0.92 μM as determined in BLI assay.
-
ab223110 analyzed by reduced SDS-PAGE and stained overnight with Coomassie Blue. The protein migrates as 42-50 kDa under reducing conditions due to glycosylation.
-
FACS assay shows that recombinant Human TIGIT Protein, Mouse IgG2a Fc Tag (ab223110) can bind to 293T cell overexpressing human CD155. The concentration of TIGIT used is 0.03 μg/ml
-
Serial dilutions of TIGIT antibody antibody (1:2 serial dilutions, from 20 μg/mL to 0.0097 μg/mL) were added into Human TIGIT (ab223110): Biotinylated Human CD112, Fc Tag (ab246048) binding reactions. Background was subtracted from data points before curve fitting.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab223110 has not yet been referenced specifically in any publications.