Recombinant Human TIL/TLR1 protein (ab157264)

Overview

Description

  • Nature
    Recombinant
  • Source
    NSO cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRIL IISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFN AFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGET YGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCV LEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVW YFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFS NMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTEL ETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKS LLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELN VAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDN PFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSE LSCNIT
    • Molecular weight
      120 kDa
    • Amino acids
      25 to 580

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute in 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • CD281
    • CD281 antigen
    • KIAA0012
    • LPRS5
    • rsc786
    • TIL
    • TIL. LPRS5
    • Tlr1
    • TLR1_HUMAN
    • Toll (Drosophila) homolog
    • Toll like receptor 1
    • Toll-like receptor 1
    • Toll/interleukin-1 receptor-like protein
    see all
  • Function
    Participates in the innate immune response to microbial agents. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity
    Ubiquitous. Highly expressed in spleen, ovary, peripheral blood leukocytes, thymus and small intestine.
  • Sequence similarities
    Belongs to the Toll-like receptor family.
    Contains 12 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt

References

ab157264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up