Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPTTTVPTTMSIPTT TTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPV ATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWN NNQTQLFLEHSLLTANTTKG
    • Molecular weight
      31 kDa including tags
    • Amino acids
      21 to 290
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by ability to inhibit anti-CD3 induced proliferation of stimulated human T cells. Human T lymphocytes cultured for 72 hours with PHA were incubated for an additional 3 days in 96 well plates coated with 500 ng/ml anti-CD3 and rhTIM1. The ED50 for this effect is typically 0.15-1.0 µg/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile PBS to a final concentration of 100 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD365
    • HAVCR
    • HAVCR 1
    • HAVcr-1
    • Havcr1
    • Hepatitis A virus cellular receptor 1
    • Kidney injury molecule 1
    • KIM 1
    • KIM-1
    • T cell immunoglobin domain and mucin domain protein 1
    • T cell immunoglobulin mucin family member 1
    • T cell immunoglobulin mucin receptor 1
    • T-cell immunoglobulin and mucin domain-containing protein 1
    • T-cell membrane protein 1
    • TIM
    • TIM-1
    • TIM1
    • TIMD 1
    • TIMD-1
    • TIMD1
    • TIMD1_HUMAN
    see all
  • Function
    May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair.
  • Tissue specificity
    Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • Purity of ab155620 determined by SDS-PAGE analysis under reduced conditions and staining overnight with Coomassie Blue. Lane 1- MW marker Lane 2- ab155620

References

ab155620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up