Description

  • Product name

    Recombinant human TIM 1 protein (Fc Chimera Active)
    See all TIM 1 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated Human T cells.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPMTTVPTTTVPTTM SIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQ NHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESS DGLWNNNQTQLFLEHSLLTANTTKG
    • Predicted molecular weight

      110 kDa including tags
    • Amino acids

      21 to 295
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of mouse IgG2a.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • CD365
    • HAVCR
    • HAVCR 1
    • HAVcr-1
    • Havcr1
    • Hepatitis A virus cellular receptor 1
    • Kidney injury molecule 1
    • KIM 1
    • KIM-1
    • T cell immunoglobin domain and mucin domain protein 1
    • T cell immunoglobulin mucin family member 1
    • T cell immunoglobulin mucin receptor 1
    • T-cell immunoglobulin and mucin domain-containing protein 1
    • T-cell membrane protein 1
    • TIM
    • TIM-1
    • TIM1
    • TIMD 1
    • TIMD-1
    • TIMD1
    • TIMD1_HUMAN
    see all
  • Function

    May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair.
  • Tissue specificity

    Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab214996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up