Overview

  • Product name
    Recombinant Human TIM50 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVV DCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTV
    • Amino acids
      301 to 400
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homolog of yeast Tim50
    • Import inner membrane translocase subunit TIM 50
    • Import inner membrane translocase subunit TIM50
    • Import inner membrane translocase subunit TIM50 mitochondrial
    • MGC102733
    • Mitochondrial import inner membrane translocase subunit TIM50
    • TIM 50
    • TIM 50L
    • TIM50
    • Tim50 like protein
    • TIM50_HUMAN
    • TIM50L
    • TIMM 50
    • TIMM50
    • Translocase of inner mitochondrial membrane 50 homolog
    • translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
    • Translocase of inner mitochondrial membrane 50 homolog (yeast)
    • Translocase of inner mitochondrial membrane 50, yeast, homolog of
    see all
  • Function
    Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Has some phosphatase activity in vitro; however such activity may not be relevant in vivo. Isoform 2 may participate in the release of snRNPs and SMN from the Cajal body.
  • Tissue specificity
    Widely expressed. Expressed at higher level in brain, kidney and liver (at protein level).
  • Sequence similarities
    Belongs to the TIM50 family.
    Contains 1 FCP1 homology domain.
  • Domain
    The FCP1 homology domain does not contain the canonical D-x-D-x-[TV] active site, suggesting that it probably does not display phosphatase activity in vivo.
  • Cellular localization
    Mitochondrion inner membrane and Nucleus speckle. Nuclear and enriched in speckles with snRNPs.
  • Information by UniProt

Images

  • ab153573 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up