Recombinant Human TIMM22 protein (ab162269)

Overview

  • Product name
    Recombinant Human TIMM22 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGI PSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGF DPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTS DWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR
    • Amino acids
      1 to 194
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Mitochondrial import inner membrane translocase subunit Tim22
    • Putative membrane protein
    • Testis expressed sequence 4
    • TEX 4
    • TEX4
    • TIM 22
    • TIM22
    • TIMM 22
    • Translocase of inner mitochondrial membrane 22 homolog
    see all
  • Relevance
    TIMM22 is an essential core component of the TIM22 protein insertion complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated, signal-gated hydrophilic high-conductance channel. It forms a twin-pore translocase that uses the membrane potential as an external driving force in 2 voltage-dependent steps.
  • Cellular localization
    Mitochondrion inner membrane; Multi-pass membrane protein.

Images

  • ab162269 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up