Description

  • Product name

    Recombinant Human TIMM23/TIM23 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDP RYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGL KETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRG AEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHM KGSLLQQSL
    • Amino acids

      1 to 209
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TIMM23

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC22767
    • MGC93478
    • Mitochondrial import inner membrane translocase subunit Tim23
    • Predicted protein of HQ1197
    • PRO1197
    • TIM23
    • TIMM 23
    • TIMM23
    • Translocase of inner mitochondrial membrane 23 (yeast) homolog
    • Translocase of inner mitochondrial membrane 23 homolog (yeast)
    • Translocase of inner mitochondrial membrane 23 homolog B
    • Translocation of mitochondrial precursor proteins
    see all
  • Relevance

    TIMM23 belongs to the Tim17/Tim22/Tim23 family and is an essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
  • Cellular localization

    Mitochondrion inner membrane; Multi-pass membrane protein.

Images

  • ab153080 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up