Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDS RTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
    • Amino acids
      1 to 83
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DDP2
    • Deafness dystonia protein 2
    • FLJ21744
    • MGC102866
    • MGC117373
    • Mitochondrial import inner membrane translocase subunit Tim8 B
    • Small zinc finger like protein DDP2
    • TIM8B
    • Translocase of inner mitochondrial membrane 8 homolog b
    • Translocase of inner mitochondrial membrane 8 homolog B (yeast)
    see all
  • Relevance
    TIMM8B, Translocase of inner mitochondrial membrane 8 homolog b, is a probable mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acting as a chaperone-like protein it protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.
  • Cellular localization
    Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side

Images

  • ab161999 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up