Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCTCVPPHPQTAFCNSDLVIRAKFVGTPEV NQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNR SEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTV FPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSL RSQIA
    • Molecular weight
      23 kDa including tags
    • Amino acids
      24 to 207
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_003245. This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab203722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names
    • Clgi
    • Collagenase inhibitor
    • Collagenase inhibitor, Human
    • EPA
    • EPO
    • Erythroid Potentiating Activity
    • Erythroid-potentiating activity
    • Fibroblast collagenase inhibitor
    • FLJ90373
    • HCI
    • Human Collagenase Inhibitor
    • Metalloproteinase inhibitor 1
    • Metalloproteinase inhibitor 1 precursor
    • OTTHUMP00000023214
    • TIMP
    • TIMP 1
    • TIMP metallopeptidase inhibitor 1
    • TIMP-1
    • Timp1
    • TIMP1 protein
    • TIMP1_HUMAN
    • Tissue Inhibitor of Metalloproteinase 1
    • Tissue inhibitor of metalloproteinases
    • Tissue inhibitor of metalloproteinases 1
    • Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor
    see all
  • Function
    Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14.
  • Sequence similarities
    Belongs to the protease inhibitor I35 (TIMP) family.
    Contains 1 NTR domain.
  • Post-translational
    modifications
    The activity of TIMP1 is dependent on the presence of disulfide bonds.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab203722 (3µg).

References

ab203722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up