Description

  • Product name

    Recombinant Human TINAGL1 protein
    See all TINAGL1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAIC YCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDN CNRCTCQENRQWQCDQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLD EGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLIHEPL DQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCR GGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKR QATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHE DFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYW TAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHHVDHH HHHH
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      22 to 467
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 467. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 0.03% DTT, 0.03% EDTA, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Androgen regulated gene 1
    • ARG1
    • GIS5
    • Glucocorticoid inducible protein
    • Glucocorticoid inducible protein 5
    • LCN7
    • LIECG3
    • Lipocalin 7
    • Lipocalin7
    • OLRG 2
    • OLRG2
    • Oxidized LDL responsive gene 2
    • Oxidized LDL responsive gene 2 protein
    • P3ECSL
    • TIN Ag related protein
    • TIN Ag RP
    • TINAG like 1
    • TINAGL
    • TINAGL 1
    • TINAGRP
    • Tubulointerstitial nephritis antigen like
    • Tubulointerstitial nephritis antigen like 1
    • Tubulointerstitial nephritis antigen related protein
    see all
  • Relevance

    TINAGL1 (Tubulointerstitial nephritis antigen-like 1) may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells.
  • Cellular localization

    Secreted

References

ab191923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up