Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAETEALSKLREDFRMQNKSVFILGASGET GRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYAS AFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLL SSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG EWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAI HDLGKAHGSLKP
    • Molecular weight

      29 kDa including tags
    • Amino acids

      1 to 242
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    ab117665 is purified by proprietary chromatographic techniques.
  • Form

    Liquid
  • Additional notes

    Although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol

General Info

  • Alternative names

    • 30 kDa HIV 1 TAT interacting protein
    • 30 kDa HIV-1 TAT-interacting protein
    • 30 kDa HIV1 TAT interacting protein
    • CC3
    • FLJ26963
    • HIV 1 Tat interacting protein 2
    • HIV 1 Tat interacting protein 2 30kDa
    • HIV-1 TAT-interactive protein 2
    • HTAI2_HUMAN
    • HTATIP 2
    • HTATIP2
    • Oxidoreductase HTATIP2
    • SDR44U1
    • Short chain dehydrogenase/reductase family 44U member 1
    • Tat interacting protein (30kDa)
    see all
  • Function

    Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.
  • Tissue specificity

    Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas and neuroblastomas.
  • Domain

    Unique C-terminus confers high proteasome-dependent instability to isoform 2.
  • Cellular localization

    Cytoplasm. Nucleus envelope.
  • Information by UniProt

References

ab117665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up