Overview

  • Product name
    Recombinant Human TIPE2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYT HSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMT ALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHF SDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
    • Amino acids
      1 to 184
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously known as Tumor necrosis factor alpha-induced protein 8-like protein 2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW610835
    • FLJ23467
    • Inflammation factor 20
    • Inflammation factor protein 20
    • TIPE2
    • TNF alpha-induced protein 8-like protein 2
    • TNFAIP8-like protein 2
    • TNFAIP8L2
    • TP8L2_HUMAN
    • Tumor necrosis factor alpha induced protein 8 like 2
    • Tumor necrosis factor alpha-induced protein 8-like protein 2
    see all
  • Function
    Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis.
  • Sequence similarities
    Belongs to the TNFAIP8 family. TNFAIP8L2 subfamily.
  • Domain
    The central region was initially thought to constitute a DED (death effector) domain. However, 3D-structure data reveal a previously uncharacterized fold that is different from the predicted fold of a DED (death effector) domain. It consists of a large, hydrophobic central cavity that is poised for cofactor binding.
  • Information by UniProt

Images

  • ab164054 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up