Overview

  • Product name
    Recombinant Human TIPRL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMF GDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEH SKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFF EEVLLFEDELHDHGVSSLSVKIPGGGHL
    • Amino acids
      1 to 178
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810011K17Rik
    • dJ69E11.3
    • MGC3794
    • Putative MAPK activating protein PM10
    • Putative MAPK-activating protein PM10
    • RP1-69E11.1
    • Tip
    • TIP41
    • TIP41-like protein
    • tiprl
    • TIPRL_HUMAN
    • TOR signaling pathway regulator
    • TOR Signaling Pathway Regulator like
    • Type 2A-interacting protein
    see all
  • Function
    May be a allosteric regulator of serine/threonine-protein phosphatase 2A (PP2A). Isoform 1 inhibits catalytic activity of the PP2A(D) core complex in vitro. The PP2A(C):TIPRL complex does not show phosphatase activity. May play a role in the regulation of ATM/ATR signaling pathway controlling DNA replication and repair.
  • Sequence similarities
    Belongs to the TIP41 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab166096 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up