Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQP TSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAA QDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPG FLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGR GPDGGFRQVKEAVMRYLQTLSWHLLYHGTPEIGVKLETENPCRASDSHKC DKRYRE
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 256

Specifications

Our Abpromise guarantee covers the use of ab132974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adapter protein wyatt
    • FLJ42305
    • MAL
    • MyD88 adapter like protein
    • TIR domain containing adapter protein
    • Toll interleukin 1 receptor (TIR) domain containing adaptor protein
    • Toll interleukin 1 receptor domain containing adapter protein
    • Toll like receptor adaptor protein
    • Wyatt
    see all
  • Relevance

    The Toll-like receptor (TLR) family in mammals comprises a family of transmembrane proteins characterized by multiple copies of leucine rich repeats in the extracellular domain and IL-1 receptor motif in the cytoplasmic domain. Like its counterparts in Drosophila, TLRs signal through adaptor molecules. The TLR family is a phylogenetically conserved mediator of innate immunity that is essential for microbial recognition. Ten human homologs of TLRs (TLR1-10) have been described. TIRAP (TIR domain-containing adaptor protein) is an adaptor protein used by TLR4. Blocking TIRAP inhibits TLR4-mediated signaling events, including DC maturation and cytokine production. Function: Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6. Tissue specificity: Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain. Post-translational modification: Phosphorylated by IRAK1 and IRAK4. Also phosphorylated by BTK. Sequence similarities: Contains 1 TIR domain.
  • Cellular localization

    Cytoplasmic

Images

  • 12.5% SDS-PAGE analysis of ab132974 stained with Coomassie Blue.

References

ab132974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up