Description

  • Product name

    Recombinant Human TIS11D protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP GFLRRHSASNLHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGT LKEPSGGGGTALLNKENKFRDRSFSENGDRSQHLLHLQQQQKGGGGSQIN STRYKTELCRPFEESGTCKYGEKCQFAHGFHELRSLTRHPKYKTELCRTF HTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRDALHLGFPREP RPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS SSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPC AACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQ QQQQGLAPPAQPPAPPSATLPAGAAAPPSPPFSFQLPRRLSDSPVFDAPP SPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPGRRLPIFSRLSISDD
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      1 to 497

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BRF2
    • Butyrate response factor 2
    • C3H1 type-like 2
    • EGF response factor 2
    • EGF-response factor 2
    • ERF 2
    • ERF-2
    • ERF2
    • Protein TIS11D
    • RNF162C
    • TIS11D
    • TISD_HUMAN
    • ZFP36 like 2
    • ZFP36 ring finger protein like 2
    • ZFP36-like 2
    • Zfp36l2
    • Zinc finger protein 36
    • Zinc finger protein 36, C3H type like 1
    • zinc finger protein 36, C3H type like 2
    • Zinc finger protein 36, C3H1 type like 2
    • Zinc finger protein, C3H type, 36 like 2
    see all
  • Function

    mRNA-binding protein that plays a key role in self-renewal of erythroid cells in response to glucocorticoids. Specifically binds to the AU-rich element (ARE) in the 3'-UTR of target mRNAs, promoting their deadenylation and degradation (PubMed:14981510). Specifically expressed in burst-forming unit-erythroid (BFU-E) progenitors in response to glucocorticoids and acts as a negative regulator of erythroid cell differentiation: promotes self-renewal of erythroid cells by binding mRNAs that are induced or highly expressed during terminal erythroid differentiation and promotes their degradation, preventing erythroid cell differentiation. Down-regulated during erythroid differentiation from the BFU-E stage, stabilizing mRNAs required for terminal differentiation.
  • Involvement in disease

    Defects in ZFP36L2 may be a cause of leukemias. Frameshfits mutations disrupting ZFP36L2 have been found in a patient with acute myeloid leukemia (PubMed:21109922).
  • Sequence similarities

    Contains 2 C3H1-type zinc fingers.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152243 stained with Coomassie Blue.

References

ab152243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up