Description

  • Product name

    Recombinant Human Tissue Factor protein (His tag)
    See all Tissue Factor proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCF YTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEF TPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKD LIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNR KSTDSPHHHHHHHH
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      33 to 238
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab245786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Centrifuge vial prior to opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.

General Info

  • Alternative names

    • CD142
    • CD142 antigen
    • Coagulation factor III
    • Coagulation factor III (thromboplastin tissue factor)
    • F3
    • FLJ17960
    • TF
    • TF_HUMAN
    • TFA
    • Thromboplastin
    • Tissue factor
    see all
  • Function

    Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
  • Sequence similarities

    Belongs to the tissue factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab245786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up