Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCIS DNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYS HDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSF PDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPL MCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENSVDHHHH HH
    • Molecular weight

      28 kDa including tags
    • Amino acids

      19 to 262
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Form

    Liquid
  • Additional notes

    Protein previously labeled as Kallikrein 1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% Calcium chloride, 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • Glandular kallikrein 1
    • hK 1
    • hK1
    • Kallikrein serine protease 1
    • Kallikrein-1
    • Kidney/pancreas/salivary gland kallikrein
    • Klk 6
    • KLK1
    • KLK1_HUMAN
    • Klk6
    • KLKR
    • Tissue kallikrein
    see all
  • Function

    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Tissue specificity

    Isoform 2 is expressed in pancreas, salivary glands, kidney, colon, prostate gland, testis, spleen and the colon adenocarcinoma cell line T84.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    The O-linked polysaccharides on Ser-93, Ser-104 and Ser-167 are probably the mucin type linked to GalNAc. In PubMed:3163150, GalNAc was detected with the corresponding peptides but not located.
  • Information by UniProt

References

ab151809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up