Overview

  • Product name

    Recombinant Human TJP2/ZO2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRS WEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRG
    • Amino acids

      121 to 218
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TJP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C9DUPq21.11
    • DFNA51
    • DUP9q21.11
    • Friedreich ataxia region gene X104 (tight junction protein ZO-2)
    • MGC26306
    • PFIC4
    • Tight junction protein 2
    • Tight junction protein ZO 2
    • Tight junction protein ZO-2
    • TJP2
    • X104
    • ZO 2
    • ZO-2
    • ZO2
    • ZO2_HUMAN
    • Zona occludens 2
    • Zona occludens protein 2
    • Zonula occludens protein 2
    see all
  • Function

    Plays a role in tight junctions and adherens junctions.
  • Tissue specificity

    This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues.
  • Involvement in disease

    Defects in TJP2 are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell junction > adherens junction. Cell membrane. Cell junction > tight junction. Nucleus. Also nuclear under environmental stress conditions and in migratory endothelial cells and subconfluent epithelial cell cultures.
  • Information by UniProt

Images

  • ab160480 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up