Description

  • Product name

    Recombinant Human TL1A protein
    See all TL1A proteins and peptides
  • Biological activity

    ab157061 binds Human DR3 and DcR3.
  • Purity

    >= 85 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIP ESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPT QLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKED KTFFGAFLL
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      93 to 251
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Flow Cytometry

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab157061 binds Human DR3 and DcR3.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 100µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names

    • MGC129934
    • MGC129935
    • tl1
    • TL1 A
    • tl1a
    • tnf ligand related molecule 1
    • TNF ligand-related molecule 1
    • tnf superfamily ligand tl1a
    • TNF15_HUMAN
    • TNFSF15
    • Tumor necrosis factor (ligand) superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15, secreted form
    • Vascular endothelial cell growth inhibitor
    • Vascular endothelial growth inhibitor
    • Vascular endothelial growth inhibitor 192a
    • vegi
    • VEGI192A
    see all
  • Function

    Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
  • Tissue specificity

    Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt

References

ab157061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up