Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLSDKEVE TPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKISDYFEFAGGSAPGTSPG RSVPPVARSSPQHSLSNPLPRRVEQP
    • Amino acids

      1 to 126
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC44450
    • PKU alpha
    • PKU-alpha
    • Serine/threonine kinase
    • Serine/threonine protein kinase tousled like 2
    • Serine/threonine-protein kinase tousled-like 2
    • TLK 2
    • tlk2
    • TLK2_HUMAN
    • Tousled like kinase 2
    • Tousled-like kinase 2
    see all
  • Function

    Rapidly and transiently inhibited by phosphorylation following the generation of DNA double-stranded breaks during S-phase. This is cell cycle checkpoint and ATM-pathway dependent and appears to regulate processes involved in chromatin assembly.
  • Tissue specificity

    Widely expressed. Present in fetal placenta, liver, kidney, pancreas, heart and skeletal muscle. Also found in adult cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153152 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up