Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDF AGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV
    • Amino acids
      121 to 220
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD282
    • CD282 antigen
    • TIL 4
    • TIL4
    • TLR 2
    • TLR2
    • TLR2_HUMAN
    • Toll like receptor 2
    • Toll like receptor 2 precursor
    • Toll-like receptor 2
    • Toll/interleukin 1 receptor like 4
    • Toll/interleukin 1 receptor like protein 4
    • Toll/interleukin receptor like protein 4
    • Toll/interleukin-1 receptor-like protein 4
    see all
  • Function
    Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6.
  • Tissue specificity
    Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues.
  • Sequence similarities
    Belongs to the Toll-like receptor family.
    Contains 14 LRR (leucine-rich) repeats.
    Contains 1 TIR domain.
  • Post-translational
    modifications
    Glycosylation of Asn-442 is critical for secretion of the N-terminal ectodomain of TLR2.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159715 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

There is GST tag at the N-terminus.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up