Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYIS NSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSS WFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRK DFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFV DVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQ VMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLH IPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLS ENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNI DISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNN LNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQ LDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPS HVRGQQVQDVRLSVSECHRTLEHHHHHH
    • Molecular weight
      66 kDa including tags
    • Amino acids
      19 to 588
    • Tags
      His tag C-Terminus
    • Additional sequence information
      NP_003255.

Specifications

Our Abpromise guarantee covers the use of ab222352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    ab222352 was purified by conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names
    • CD282
    • CD282 antigen
    • TIL 4
    • TIL4
    • TLR 2
    • TLR2
    • TLR2_HUMAN
    • Toll like receptor 2
    • Toll like receptor 2 precursor
    • Toll-like receptor 2
    • Toll/interleukin 1 receptor like 4
    • Toll/interleukin 1 receptor like protein 4
    • Toll/interleukin receptor like protein 4
    • Toll/interleukin-1 receptor-like protein 4
    see all
  • Function
    Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6.
  • Tissue specificity
    Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues.
  • Sequence similarities
    Belongs to the Toll-like receptor family.
    Contains 14 LRR (leucine-rich) repeats.
    Contains 1 TIR domain.
  • Post-translational
    modifications
    Glycosylation of Asn-442 is critical for secretion of the N-terminal ectodomain of TLR2.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222352.

References

ab222352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up