Description

  • Product name

    Recombinant Human TLR3 protein (His tag)
    See all TLR3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFT RYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFC TNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLEN LQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGR LFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLK WTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLF NVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKS NMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKI ESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLT RNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANIN DDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESN GFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLI TSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELS SHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELLEHHHHHH
    • Predicted molecular weight

      79 kDa including tags
    • Amino acids

      23 to 704
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_003256.

Specifications

Our Abpromise guarantee covers the use of ab233604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT, 20% Glycerol

General Info

  • Alternative names

    • CD283
    • CD283 antigen
    • IIAE2
    • TLR 3
    • Tlr3
    • TLR3_HUMAN
    • Toll Like Receptor 3
    • Toll-like receptor 3
    see all
  • Function

    Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR3 is a nucleotide-sensing TLR which is activated by double-stranded RNA, a sign of viral infection. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity

    Expressed at high level in placenta and pancreas. Also detected in CD11c+ immature dendritic cells. Only expressed in dendritic cells and not in other leukocytes, including monocyte precursors. TLR3 is the TLR that is expressed most strongly in the brain, especially in astrocytes, glia, and neurons.
  • Involvement in disease

    Defects in TLR3 are associated with herpes simplex encephalitis type 2 (HSE2) [MIM:613002]. HSE is a rare complication of human herpesvirus 1 (HHV-1) infection, occurring in only a small minority of HHV-1 infected individuals. HSE is characterized by hemorrhagic necrosis of parts of the temporal and frontal lobes. Onset is over several days and involves fever, headache, seizures, stupor, and often coma, frequently with a fatal outcome. Note=TLR3 mutations predispose otherwise healthy individuals to isolated herpes simplex encephalitis through a mechanism that involves impaired IFNs production and reduced immune defense against viral infection in the central nervous system.
  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 22 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
    Contains 1 TIR domain.
  • Domain

    ds-RNA binding is mediated by LRR 1 to 3, and LRR 17 to 18.
  • Post-translational
    modifications

    Heavily N-glycosylated, except on that part of the surface of the ectodomain that is involved in ligand binding.
  • Cellular localization

    Endoplasmic reticulum membrane. Endosome membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab233604.

    Observed MW: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab233604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up