Recombinant Human TLR7 protein (ab153341)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human TLR7 protein
See all TLR7 proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINH IPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL -
Predicted molecular weight
37 kDa including tags -
Amino acids
27 to 126 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab153341 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- PRO285
- TLR 7
- Tlr7
see all -
Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. -
Tissue specificity
Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells. -
Sequence similarities
Belongs to the Toll-like receptor family.
Contains 27 LRR (leucine-rich) repeats.
Contains 1 TIR domain. -
Cellular localization
Endoplasmic reticulum membrane. Endosome. Lysosome. Cytoplasmic vesicle > phagosome. Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab153341 has not yet been referenced specifically in any publications.