Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDD IEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight

      43 kDa including tags
    • Amino acids

      16 to 162
    • Tags

      proprietary tag C-Terminus
    • Additional sequence information

      The recombinant fragment was fused with an FC tag.

Specifications

Our Abpromise guarantee covers the use of ab185864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab185864 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as TREML1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from an 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in 3X PBS.

General Info

  • Alternative names

    • dJ238O23.3
    • GLTL1825
    • MGC119173
    • PRO3438
    • TLT 1
    • TLT-1
    • TLT1
    • TREM like transcript 1
    • Trem like transcript 1 protein
    • Trem-like transcript 1 protein
    • TREML 1
    • Treml1
    • Triggering receptor expressed on myeloid cells like 1
    • Triggering receptor expressed on myeloid cells like protein 1
    • Triggering receptor expressed on myeloid cells-like protein 1
    • TRML1_HUMAN
    see all
  • Function

    Cell surface receptor that may play a role in the innate and adaptive immune response.
  • Tissue specificity

    Detected in platelets, monocytic leukemia and in T-cell leukemia.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues.
  • Cellular localization

    Cell membrane. Cytoplasm. Sequestered in cytoplasmic vesicles in resting platelets. Transported to the cell surface after stimulation by thrombin. Soluble fragments can be released into the serum by proteolysis.
  • Information by UniProt

References

ab185864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up