Description

  • Product name

    Recombinant Human TLX3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGG RPGATYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAV PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTV TRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALA KSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQK SLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
    • Amino acids

      1 to 291
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • homeo box 11-like 2
    • Homeobox protein Hox 11L2
    • Homeobox protein Hox-11L2
    • HOX11 L2
    • HOX11L2
    • RNX
    • T cell leukemia homeobox 3
    • T cell leukemia homeobox protein 3
    • T-cell leukemia homeobox protein 3
    • TLX 3
    • TLX3
    • TLX3_HUMAN
    see all
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162313 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up