Recombinant Human TM4SF2 protein (ab159719)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTS PYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETN
    • Amino acids
      113 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159719 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A15
    • CCG B7
    • CD231
    • CD231 antigen
    • Cell surface glycoprotein A15
    • DXS1692E
    • Membrane component chromosome X surface marker 1
    • Membrane component X chromosome surface marker 1
    • MRX58
    • MXS1
    • T cell acute lymphoblastic leukemia associated antigen 1
    • T-cell acute lymphoblastic leukemia-associated antigen 1
    • TALLA
    • TALLA 1
    • TALLA-1
    • TALLA1
    • Tetraspanin 7
    • Tetraspanin-7
    • TM4SF2
    • TM4SF2b
    • Transmembrane 4 superfamily 2b
    • Transmembrane 4 superfamily member 2
    • Transmembrane protein A15
    • TSN7_HUMAN
    • Tspan 7
    • Tspan-7
    • TSPAN7
    see all
  • Information by UniProt

Images

  • ab159719 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159719 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159719.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up