Overview

  • Product name

    Recombinant Human TM4SF4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFG GILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGF LGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPL NVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDG PV
    • Amino acids

      1 to 202
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ31015
    • il TMP
    • ILTMP
    • Intestinal and liver (il) tetraspan membrane protein
    • Intestine and liver tetraspan membrane protein
    • Lrtm4
    • MGC19127
    • Transmembrane 4 L six family member 4
    • transmembrane 4 L6 family member 4
    • Transmembrane 4 superfamily member 4
    see all
  • Relevance

    TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TM4SF4 is a cell surface glycoprotein that regulates the adhesive and proliferative status of intestinal epithelial cells and can mediate density-dependent cell proliferation. Glycosylation is required for the growth inhibitory effect.
  • Cellular localization

    Integral to plasma membrane.

Images

  • ab159723 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up