Description

  • Product name

    Recombinant Human TMC6 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAHSFGESYRVGSTSGIHAITVFCSWDYKVTQKRASRLQQDNIRTRLKEL LAEWQLRHSPRSVCGRLRQAAVLGLVWLLCLGTALGCAVAVHVFSEFMIQ SPEAAGQEAVLLVLPLVVGLLNLGAPYLCRVLAALEPHDSPVLEVYVAIC RNLILKLAILGTLCYHWLGRRVGVLQGQCWEDFVGQELYRFLVMDFVLML LDTLFGELVWRIISEKKLKRRRKPEFDIARNVLELIYGQTLTWLGVLFSP LLPAVQIIKLLLVFYVKKTSLLANCQAPRRPWLASHMSTVFLTLLCFPAF LGAAVFLCYAVWQVKPSSTCGPFRTLDTMYEAGRVWVRHLEAAGPRVSWL PWVHRYLMENTFFVFLVSALLLAVIYLNIQVVRGQRKVICLLKEQISNEG EDKIFLINKLHSIYERKEREERSRVGTTEEAAAPPALLTDEQDA
    • Amino acids

      1 to 444
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Epidermodysplasia verruciformis protein 1
    • EV1
    • EVER1
    • EVIN1
    • LAK 4P
    • LAK4P
    • Protein LAK 4
    • Protein LAK4
    • Transmembrane channel like protein 6
    see all
  • Relevance

    Defects in TMC6 are a cause of epidermodysplasia verruciformis, a rare autosomal recessive genodermatosis associated with a high risk of skin carcinoma that results from an abnormal susceptibility to infection by specific human papillomaviruses. Infection leads to persistent wart-like or macular lesions. TMC6 is expressed in placenta, prostate, testis, activated T-lymphocytes and lymphokine-activated killer (LAK) lymphocytes. There are four named isoforms.
  • Cellular localization

    Endoplasmic reticulum membrane; Multi-pass membrane protein

Images

  • ab161415 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up