Description

  • Product name

    Recombinant Human TMED1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTE AGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLD
    • Amino acids

      50 to 148
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • IL1RL1 binding protein
    • IL1RL1L
    • IL1RL1LG
    • Interleukin-1 receptor-like 1 ligand
    • Interleukin1 receptor like 1 ligand
    • MGC1270
    • p24 family protein gamma 1
    • p24gamma1
    • Putative T1/ST2 receptor binding protein
    • Putative T1/ST2 receptor-binding protein
    • ST2L
    • T1/ST2 receptor binding protein
    • TMED 1
    • Tmed1
    • TMED1_HUMAN
    • Tp24
    • Transmembrane emp24 domain containing 1
    • Transmembrane emp24 domain containing protein 1
    • Transmembrane emp24 domain-containing protein 1
    • Transmembrane emp24 protein transport domain containing 1
    • Transmembrane p24 trafficking protein 1
    see all
  • Function

    Potential role in protein trafficking.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the EMP24/GP25L family.
    Contains 1 GOLD domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab161247 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up