Overview

  • Product name
    Recombinant Human TMED5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQ PMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETE VGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILD MKLEDILESINSIKSRLSKSGHIQILLRAFEARDRNIQESNFDRVNFWSM VNLVVMVVVSAIQVYMLKSLFEDKRKSRT
    • Amino acids
      1 to 229
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGI 100
    • DKFZp781B2248
    • p24 family protein gamma-2
    • p24gamma2
    • p28
    • RP5 976O13.2
    • TMED 5
    • TMED5
    • TMED5_HUMAN
    • Transmembrane emp24 domain containing protein 5
    • Transmembrane emp24 domain-containing protein 5
    • Transmembrane emp24 protein transport domain containing 5
    • UNQ397/PRO733
    see all
  • Function
    Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Required for the maintenance of the Golgi apparatus; involved in protein exchange between Golgi stacks during assembly. Probably not required for COPI-vesicle-mediated retrograde transport.
  • Sequence similarities
    Belongs to the EMP24/GP25L family.
    Contains 1 GOLD domain.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus > cis-Golgi network membrane. Endoplasmic reticulum-Golgi intermediate compartment membrane. Probably cycles between compartments of the early secretatory pathway.
  • Information by UniProt

Images

  • ab162383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up