Overview

  • Product name
    Recombinant Human TMEM1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVH SACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
    • Amino acids
      1162 to 1257
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EHOC 1
    • EHOC1
    • Epilepsy holoprosencephaly candidate 1
    • Epilepsy holoprosencephaly candidate 1 protein
    • FLJ54223
    • FLJ54817
    • FLJ55683
    • GT 334
    • GT334
    • GT334 protein
    • MGC126777
    • Protein GT334
    • TMEM 1
    • TMEM1
    • Trafficking protein particle complex 10
    • Trafficking protein particle complex subunit 10
    • Trafficking protein particle complex subunit 130
    • Trafficking protein particle complex subunit TMEM1
    • Transmembrane protein 1
    • Transport protein particle subunit TMEM1
    • TRAPP 130 kDa subunit
    • TRAPP subunit TMEM1
    • TRS130
    • TRS30
    see all
  • Relevance
    The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1.
  • Cellular localization
    Golgi apparatus; integral to membrane.

Images

  • ab159726 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up