Recombinant Human TMEM149 protein (ab156360)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSSQYCGRLEYWNPDNKCCSSCLQRFGPP PCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTP TPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRT PEPVPQQAWPNFLP
    • Molecular weight
      18 kDa including tags
    • Amino acids
      23 to 163
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156360 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • F630003I17Rik
    • FLJ22573
    • IGF like family receptor 1
    • IGF-like family receptor 1
    • IGFLR1
    • IGFR1_HUMAN
    • MGC30332
    • Transmembrane protein 149
    • U2 small nuclear RNA auxiliary factor 1 like 4
    • U2 small nuclear RNA auxiliary factor 1-like 4
    • U2(RNU2) small nuclear RNA auxiliary factor 1 like 4
    • U2AF1L4
    see all
  • Function
    Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab156360.

References

ab156360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up