Overview

  • Product name
    Recombinant Human TMEM49 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQP LITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQ QYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAY ECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAI GELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQK LVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLH HKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLN SEEKTK
    • Amino acids
      1 to 406
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP566I133
    • ectopic P-granules autophagy protein 3 homolog
    • NF E2 induceble protein 2
    • NF E2 inducible protein 2
    • ni 2
    • protein ni 2
    • Tango5
    • TDC1
    • TMEM49
    • Transmembrane protein 49
    • transport and golgi organization 5 homolog
    • Vacuole membrane protein 1
    • vmp1
    • VMP1_HUMAN
    see all
  • Function
    Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions.
  • Sequence similarities
    Belongs to the VMP1 family.
  • Cellular localization
    Endoplasmic reticulum-Golgi intermediate compartment membrane. Cell membrane. Vacuole membrane. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab164355 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up