Description

  • Product name

    Recombinant Human TMEM49/VMP1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQP LITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQ QYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAY ECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAI GELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQK LVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLH HKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLN SEEKTK
    • Amino acids

      1 to 406
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TMEM49

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZP566I133
    • ectopic P-granules autophagy protein 3 homolog
    • NF E2 induceble protein 2
    • NF E2 inducible protein 2
    • ni 2
    • protein ni 2
    • Tango5
    • TDC1
    • TMEM49
    • Transmembrane protein 49
    • transport and golgi organization 5 homolog
    • Vacuole membrane protein 1
    • vmp1
    • VMP1_HUMAN
    see all
  • Function

    Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions.
  • Sequence similarities

    Belongs to the VMP1 family.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Cell membrane. Vacuole membrane. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab164355 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up