Description

  • Product name

    Recombinant Human TMEPAI protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIG HYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
    • Amino acids

      181 to 280
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PMEPA_HUMAN
    • PMEPA1
    • Prostate transmembrane protein, androgen induced 1
    • Solid tumor associated 1 protein
    • Solid tumor-associated 1 protein
    • STAG1
    • TMEPAI
    • Transmembrane prostate androgen induced protein
    • Transmembrane prostate androgen-induced protein
    • Transmembrane, prostate androgen induced RNA
    see all
  • Function

    Involved in down-regulation of the androgen receptor (AR). Enhances ubiquitination and proteasome-mediated degradation of AR, probably by recruiting NEDD4.
  • Tissue specificity

    Highest expression in prostate. Also expressed in ovary.
  • Sequence similarities

    Belongs to the PMEPA1 family.
  • Domain

    The WW-binding motifs mediate interaction with NEDD4.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab163440 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up