Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYIT NGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELE EAEGNITRLFVDPDDPTQNRNRIASFPGVDHHHHHH
    • Molecular weight

      15 kDa including tags
    • Amino acids

      23 to 150
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab185409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab185409 is 0.2 µM filtered.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TMIGD2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

General Info

  • Alternative names

    • CD28H
    • IGPR 1
    • IGPR1
    • immunoglobulin and proline-rich receptor 1
    • immunoglobulin-containing and proline-rich receptor 1
    • TMIG2_HUMAN
    • TMIGD2
    • Transmembrane and immunoglobulin domain containing 2
    • Transmembrane and immunoglobulin domain-containing protein 2
    • transmembrane and immunoglobulin domain-containing protein 2 variant 2
    • transmembrane and immunoglobulin domain-containing protein 2 variant 3
    • UNQ3059/PRO9879
    see all
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab185409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up