Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYIT NGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELE EAEGNITRLFVDPDDPTQNRNRIASFPG
    • Molecular weight

      41 kDa including tags
    • Amino acids

      23 to 150
    • Additional sequence information

      Extracellular domain with a human IgG1 Fc tag at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab219874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as TMIGD2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Storage: In lyophilized state for 1 year (4°C); After reconstitution under sterile conditions for 3 months (-70°C).

General Info

  • Alternative names

    • CD28H
    • IGPR 1
    • IGPR1
    • immunoglobulin and proline-rich receptor 1
    • immunoglobulin-containing and proline-rich receptor 1
    • TMIG2_HUMAN
    • TMIGD2
    • Transmembrane and immunoglobulin domain containing 2
    • Transmembrane and immunoglobulin domain-containing protein 2
    • transmembrane and immunoglobulin domain-containing protein 2 variant 2
    • transmembrane and immunoglobulin domain-containing protein 2 variant 3
    • UNQ3059/PRO9879
    see all
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab219874 on SDS-PAGE under reducing (R) and non-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The protein migrates as 45-60 kDa under reducing (R) conditions and 90-120 kDa under non-reducing (NR) conditions.

References

ab219874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up