Recombinant Human TMS1/ASC protein (ab131786)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human TMS1/ASC protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAA PAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQY QAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS -
Predicted molecular weight
42 kDa including tags -
Amino acids
47 to 195 -
Tags
GST tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab131786 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Additional notes
Protein concentration is above or equal to 0.05 ug/ul.This product was previously labelled as TMS1
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Apoptosis associated speck like protein containing a CARD
- Apoptosis-associated speck-like protein containing a CARD
- ASC
see all -
Function
Promotes caspase-mediated apoptosis. This proapoptotic activity is mediated predominantly through the activation of caspase-9. May be a component of the inflammasome, a protein complex which also includes NALP2, CARD8 and CASP1 and whose function would be the activation of proinflammatory caspases. -
Tissue specificity
Widely expressed at low levels. Detected in peripheral blood leukocytes, lung, small intestine, spleen, thymus, colon and at lower levels in placenta, liver and kidney. Very low expression in skeletal muscle, heart and brain. Detected in the leukemia cell lines HL-60 and U937, but not in Jurkat T-cell lymphoma and Daudi Burkitt's lymphoma. Detected in the melanoma cell line WM35, but not in WM793. Not detected in HeLa cervical carcinoma cells and Molt 4 lymphocytic leukemia cells. -
Sequence similarities
Contains 1 CARD domain.
Contains 1 DAPIN domain. -
Domain
Interacts with CIAS1/PYPAF1 and PYDC1 via the DAPIN domain. -
Post-translational
modificationsPhosphorylated. -
Cellular localization
Cytoplasm. Upstream of caspase activation, a redistribution from the cytoplasm to the aggregates occurs. These appear as hollow, perinuclear spherical, ball-like structures. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human TMS1/ASC protein (ab131786)12.5% SDS-PAGE analysis of ab131786 stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab131786 has not yet been referenced specifically in any publications.
