Description

  • Product name

    Recombinant Human TMTC1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNPFYFHAVNIILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPIHT EAVAGIVGRADVLACLLFLLAFLSYNRSLDQGCVGGSFPSTVSPFFLLLS LFLGTCAMLVKETGITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPG SPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAV WSMMRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLVETIWDMRNLATI FLAVVMALLSLHCLAAFKRLEHKEVLVGLLFLVFPFIPASNLFFRVGFVV AERVLYMPSMGYCILFVHGLSKLCTWLNRCGATTLIVSTVLLLLLFSWKT VKQNEIWLSRESLFRSGVQTLPHNAKVHYNYANFLKDQGRNKEAIYHYRT ALKLYPRHASALNNLGTLTRDTAEAKMYYQRALQLHPQHNRALFNLGNLL KSQEKKEEAITLLKDSIKYGPEFADAYSSLASLLAEQERFKEAEEIYQTG IKNCPDSSDLHNNYGVFLVDTGLPEKAVAHYQQAIKLSPSHHVAMVNLGR LYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQE AAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLS AIYSKQENHDKALDAIDKALQLKPKDPKVISELFFTKGNQLREQNLLDKA FESYRLAVQLNPDQAQAWMNMGGIQHIKGKYVSARAYYERALQLVPDSKL LKENLAKLDRLEKRLQEVREKDQT
    • Amino acids

      1 to 774
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARG99
    • BC023818
    • FLJ31400
    • FLJ41625
    • OLF
    • RGD1564868
    • TMTC1A
    • Transmembrane and tetratricopeptide repeat containing 1
    • Transmembrane and TPR repeat containing protein 1
    see all
  • Relevance

    TMTC1 belongs to the TMTC family. Four isoforms of the human protein are produced by alternative splicing. The function of this protein is currently unknown.
  • Cellular localization

    Membrane; Multi-pass membrane protein

Images

  • ab164450 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up