Overview

  • Product name
    Recombinant Human TMUB1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPS QPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQ EPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLG DDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLL PLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP
    • Amino acids
      1 to 246
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C7orf21
    • Chromosome 7 Open Reading Frame 21
    • Dendritic Cell-Derived Ubiquitin-Like Protein
    • DULP
    • Hepatocyte odd protein shuttling protein
    • HOPS
    • SB144
    • TMUB1
    • TMUB1_HUMAN
    • Transmembrane and ubiquitin-like domain-containing protein 1
    • Ubiquitin-like protein DULP
    • Ubiquitin-like protein SB144
    • UNQ763/PRO1555
    see all
  • Function
    May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation.
  • Sequence similarities
    Contains 1 ubiquitin-like domain.
  • Cellular localization
    Membrane. Cytoplasm. Nucleus. Predominantly nuclear during growth arrest (By similarity). Actively exported from the nucleus in dividing cells.
  • Information by UniProt

Images

  • ab164410 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up