Description

  • Product name

    Recombinant Human TMX2 protein
  • Purity

    > 95 % SDS-PAGE.
    determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDK RVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVST RYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIRE FNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      125 to 296
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab191953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 4 months.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 2X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • Cell proliferation inducing gene 26 protein
    • Cell proliferation-inducing gene 26 protein
    • CGI 31
    • Growth inhibiting gene 11
    • PDIA12
    • PIG26
    • Protein disulfide isomerase family A, member 12
    • Thioredoxin domain containing protein 14
    • Thioredoxin domain-containing protein 14
    • Thioredoxin related transmembrane protein 2
    • Thioredoxin-related transmembrane protein 2
    • tmx2
    • TMX2_HUMAN
    • TXNDC14
    see all
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 1 thioredoxin domain.
  • Domain

    The thioredoxin domain lacks the 2 redox-active cysteines, suggesting that it lacks thioredoxin activity.
    The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab191953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up