Overview

  • Product name

    Recombinant Human TMX3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYA PWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYP TIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRH RVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAV LVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVA LAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLL MDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGD SILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTAD TDGGYIEERYEVSKSENENQEQIEESKEQQEPSSGGSVVPTVQEPKDVLE KKKD
    • Amino acids

      1 to 454
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA1830
    • PDIA13
    • Protein disulfide isomerase family A, member 13
    • Protein disulfide-isomerase TMX3
    • Thioredoxin domain containing 10
    • Thioredoxin domain-containing protein 10
    • Thioredoxin-related transmembrane protein 3
    • TMX3
    • TMX3_HUMAN
    • TXNDC10
    see all
  • Function

    Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase.
  • Tissue specificity

    Widely expressed. Expressed in brain, testis, lung, skin, kidney, uterus, bone, stomach, liver, prostate, placenta, eye and muscle.
  • Sequence similarities

    Belongs to the protein disulfide isomerase family.
    Contains 1 thioredoxin domain.
  • Domain

    The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162756 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up