Recombinant human TNF beta protein (ab168044)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGF SLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQY PFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLV LSPSTVFFGAFAL
    • Molecular weight
      25 kDa including tags
    • Amino acids
      43 to 205
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab168044 binds to Human HVEM and Human and mouse TNF-R1 and TNF-R2. ab168044 kills Human TNF-R1 positive cells.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    ab168044 binds to Human HVEM and Human and mouse TNF-R1 and TNF-R2. ab168044 kills Human TNF-R1 positive cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water to a final concentration of 0.1mg/ml. Avoid freeze/thaw cycles. Further dilutions should be made with medium containing 5% fetal calf serum.

General Info

  • Alternative names
    • LTalpha
    • DIF
    • LT
    • LT alpha
    • LT-alpha
    • Lta
    • Lymphotoxin alpha
    • Lymphotoxin alpha (TNF superfamily, member 1)
    • Lymphotoxin-alpha
    • TNF B
    • TNF superfamily member 1
    • TNF, lymphocyte-derived
    • TNF-beta
    • TNFB
    • TNFB_HUMAN
    • TNFbeta
    • TNFSF1
    • TNLG1E
    • Tumor necrosis factor beta
    • tumor necrosis factor ligand 1E
    • Tumor necrosis factor ligand superfamily member 1
    see all
  • Function
    Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
  • Involvement in disease
    Genetic variations in LTA are a cause of susceptibility psoriatic arthritis (PSORAS) [MIM:607507]. PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis).
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Secreted. Membrane. The homotrimer is secreted. The heterotrimer is membrane-associated.
  • Information by UniProt

References

ab168044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up