Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYND CPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDR DTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAG FFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
    • Molecular weight

      22 kDa including tags
    • Amino acids

      22 to 211
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001056.

Specifications

Our Abpromise guarantee covers the use of ab224647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human TNF-alpha, Tag Free at 2 μg/ml (100 μl/well) can bind ab224647 with a linear range of 2-16 ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CD120a
    • FPF
    • MGC19588
    • p55
    • p55-R
    • p60
    • TBP1
    • TBPI
    • TNF R
    • TNF R55
    • TNF-R1
    • TNF-RI
    • TNFAR
    • TNFR-I
    • TNFR1
    • TNFR55
    • TNFR60
    • TNFRI
    • TNFRSF1a
    • TNR1A_HUMAN
    • Tumor necrosis factor receptor 1
    • Tumor necrosis factor receptor superfamily, member 1A
    • Tumor necrosis factor receptor type 1
    • Tumor necrosis factor receptor type I
    • Tumor necrosis factor-binding protein 1
    see all
  • Function

    Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
  • Involvement in disease

    Familial hibernian fever
    Multiple sclerosis 5
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Domain

    The domain that induces A-SMASE is probably identical to the death domain. The N-SMASE activation domain (NSD) is both necessary and sufficient for activation of N-SMASE.
    Both the cytoplasmic membrane-proximal region and the C-terminal region containing the death domain are involved in the interaction with TRPC4AP.
  • Post-translational
    modifications

    The soluble form is produced from the membrane form by proteolytic processing.
  • Cellular localization

    Cell membrane. Golgi apparatus membrane. Secreted. A secreted form is produced through proteolytic processing and Secreted. Lacks a Golgi-retention motif, is not membrane bound and therefore is secreted.
  • Information by UniProt

Images

  • Immobilized Human TNF-alpha (Tag Free) low endotoxin (HPLC-verified) at 2 µg/mL (100 µL/well) can bind Human TNFR1 (His Tag) with a linear range of 3-25 ng/mL (QC tested).
  • Human TNFR1 (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized Human TNF-alpha, Tag Free at 2 μg/ml (100 μl/well) can bind ab224647 with a linear range of 2-16 ng/ml.

  • ab224647 analyzed by SDS-PAGE under reducing conditions and stained overnight with Coomassie Blue.

    The protein migrates as 30-35 kDa under reducing conditions due to different glycosylation.

References

ab224647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up